PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.B01512.1.p
Common NameLOC105954762, MIMGU_mgv1a026438mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 221aa    MW: 24842.1 Da    PI: 8.2935
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.B01512.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1031.6e-32147204259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  Migut.B01512.1.p 147 EDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHS 204
                       8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.4E-34131204IPR003657WRKY domain
SuperFamilySSF1182901.83E-28138204IPR003657WRKY domain
PROSITE profilePS5081129.264141203IPR003657WRKY domain
SMARTSM007741.1E-37146205IPR003657WRKY domain
PfamPF031063.4E-25147203IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGFVHFEEED HHNQVLSFLV APPPPPPPSQ QLHGGANKPT TTTNYNNNGS LGFNNNHHSE  60
LVNRPSWNND QPVGGGAVDP KAANDDENCS ANTNQAAAPN YNSWWRNSSS ASGGSSSATE  120
KNKVKIRRKL REPRFCFQTR SDVDVLEDGY KWRKYGQKVV KNSLHPRSYY RCTHSNCRVK  180
KRVERLSEDC RMVITTYEGR HNHSPCDDSN SSEQDCFTTF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-25137203874Probable WRKY transcription factor 4
1wj2_A2e-25137203874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124130KIRRKLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012833896.11e-166PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY45e-71WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A022RIU01e-166A0A022RIU0_ERYGU; Uncharacterized protein
STRINGGLYMA07G13611.16e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA73362029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.13e-70WRKY family protein